@TOME v. 2.1

@TOME: a pipeline for comparative modeling of protein-ligand complexes. This meta-server, named @TOME V2, allows one to submit an amino acid sequence to embedded softwares dedicated to homologous sequences search, structural predictions and fold recognition. @TOME V2 facilitates the recognition of the better 3D template and the best automatic alignment according an important set of evaluation tools results. @TOME V2 permits also to create 3D model by comparative modeling or 3D complex by comparative docking of ligand between the experimental protein and model. Warning: Access to @TOME2 server is restricted to academic use only ! This website is free and open to all academic users and there is no login requirement. This website is optimized for Firefox.

Documentation Embedded tools HHsearch Fugue, PS3 Psiblast Psipred, P-Sea Tito, Scwrl Modeller QMean Verify3D Eval23D T-Coffee Clustalw Muscle Jalview MaxCluster Profit, Matt Plants MedusaScore XScore Autodock Pat JMol Babel ...

Title : Primary Sequence: [One letter code] eg: MPSHRNSNLKFCTVCASNNNRSMESHKVLQEAGYNVSSYGTGSAVRLPGLSIDKPNVYSFGT PYNDIYNDLLSQSADRYKSNGLLQMLDRNRRLKKAPEKWQESTKVFDFVFTCEERCFDAVCE DLMNRGGKLNKIVHVINVDIKDDDENAKIGSKAILELADMLNDKIEQCEKDDIPFEDCIMDI LTEWQSSHSQLPSLYAPSYY Email : Search for Homologous Sequences & Comparative Modeling Search for Ligands & Complexes Prediction by Comparative Docking Others Modules Ref: Pons & Labesse - Nucleic Acids Research, Web Server Issue- 2009 | CBS | ABCIS |