Submit your sequence

The meta-server @TOME, allows one to submit an amino acid sequence to embedded softwares dedicated to homologous sequences search, structural predictions and fold recognition. @TOME facilitates the recognition of the better 3D template and the best automatic alignment according an important set of evaluation tools results.

@TOME permits also to create 3D model of receptor/ligand complexes by comparative docking of ligand between the experimental protein and model. At the end, ligand of modeled complex can be used to guide the positioning of new drugs during a virtual screening steps.

This website is free and open to all users and there is no login requirement.
@TOME-2 is a meta-server that uses many tools developed by the international scientific academic community. Most of these programs are for non-commercial use only. The service is provided on a "as is" basis without warranties of any kind.

The complete description of the pipeline @TOME is in this Document

Title :
Primary Sequence:
[One letter code] eg:
RSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVP
GFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLAT
SSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMA......
See example result here (read-only)
Email :
For sending result


Search for Homologous Sequences & Comparative Modeling
Ligands Selection, Comparative Docking & Screening
Interface with Experimental Methods