Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------KDAELQEREYHLKELREQLAKQTVAIAELTEELQSKCIQLNKLQ-
2BA2 Chain:A ((5-85))GTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGKTLQLILEALQGINKRLDNLES


General information:
TITO was launched using:
RESULT:

Template: 2BA2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 2811 for 166 contacts (16.9/contact) +
2D Compatibility (PS) -5205 + (NN) -6884 + (LL) 0
1D Compatibility (HY) -1200 + (ID) 450
Total energy: -10928.0 ( -65.83 by residue)
QMean score : 0.672

(partial model without unconserved sides chains):
PDB file : Tito_2BA2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2BA2-query.scw
PDB file : Tito_Scwrl_2BA2.pdb: