Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------MITYKKLLDELKKEIGPIAKIFLNKAMESLGYDDVDDSNYKEIL---SVLKMNKELREYVEIVEERLEKEG-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3FPF Chain:A ((2-265))SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLEMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP


General information:
TITO was launched using:
RESULT:

Template: 3FPF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -13972 for 367 contacts (-38.1/contact) +
2D Compatibility (PS) -7463 + (NN) -6203 + (LL) 0
1D Compatibility (HY) -400 + (ID) 500
Total energy: -28538.0 ( -77.76 by residue)
QMean score : 0.575

(partial model without unconserved sides chains):
PDB file : Tito_3FPF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3FPF-query.scw
PDB file : Tito_Scwrl_3FPF.pdb: