Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------MQRQPVSSSRILSIGYDPDNRMLEIQFREQGTYQYLGVPERAHQNFMSAVSKGRFFDGVI--KGKFLCRKIG------------------------------------------------------------------------------------------------------------------------------------
2VQ2 Chain:A ((4-223))ANQVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAE--IYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLCGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWKIAKALGNAQAAYEYEAQLQANFPYSEELQTVLT


General information:
TITO was launched using:
RESULT:

Template: 2VQ2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 1801 for 448 contacts (4.0/contact) +
2D Compatibility (PS) -7027 + (NN) -1491 + (LL) -52
1D Compatibility (HY) -1200 + (ID) 900
Total energy: -8869.0 ( -19.80 by residue)
QMean score : 0.145

(partial model without unconserved sides chains):
PDB file : Tito_2VQ2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2VQ2-query.scw
PDB file : Tito_Scwrl_2VQ2.pdb: